Acc_NO	ORF type	length	start-end position (strand +/-)
>FG356268.1	5prime_partial	132	1-399(+)
Amino Acid sequence :
HYGRGLVDEFLAKSNVSRCVDFKETAEVIAKVGFKMFLGVGAAVTNWDADGTCCSIILEDNPLVDFVELPDTCQGLYYCNILSGVLRGALEMVSMKTEISWARDMLQGDDAFGLQVKLLK QVPEEYPYKDDE*
Physicochemical properties
Number of amino acids:		132
Molecular weight:		14,680.626
Theoretical pI:		4.454
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		18450 18700
Instability index:		21.879
aromaticity		0.098
GRAVY		-0.011
Secondary Structure Fraction
Helix		0.341
turn		0.189
sheet		0.280