Acc_NO	ORF type	length	start-end position (strand +/-)
>FG356285.1	5prime_partial	106	3-323(+)
Amino Acid sequence :
TKMLSPGVLYEIVFVIKIKKAGYVMACSSKGNTNLPDGTKQQNKVNLLDTPREEWMEITVGEFKTSNGQLGEIDISMYEIEGGNWKSGLVVKGIEIRPKNGNFNHN*
Physicochemical properties
Number of amino acids:		106
Molecular weight:		12,090.263
Theoretical pI:		9.696
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		23490 23740
Instability index:		44.204
aromaticity		0.057
GRAVY		-0.077
Secondary Structure Fraction
Helix		0.324
turn		0.210
sheet		0.219

Acc_NO	ORF type	length	start-end position (strand +/-)
>FG356285.1	complete	105	70-387(+)
Amino Acid sequence :
MSWHVPVKVILTYQMEPNNKTKSICWTPQEKNGWRSQWVSLKHLMVSLVKLTSLCMRLKVAIGRVDLLSRALKFDQRTETSITIEDVMCNHLSKSTSSIPVMCVK*
Physicochemical properties
Number of amino acids:		105
Molecular weight:		12,090.263
Theoretical pI:		9.696
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		23490 23740
Instability index:		44.204
aromaticity		0.057
GRAVY		-0.077
Secondary Structure Fraction
Helix		0.324
turn		0.210
sheet		0.219