Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356297.1 | 5prime_partial | 113 | 3-344(+) |
Amino Acid sequence : | |||
FTKLGLLNVPKWYDAGKGEYFASSSTLFVITFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSIPPNEVGYPGGIFNPLNFAPTSQAKEKELANGRLAMLAFSGLVVQHNVTGP* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 12,620.285 | ||
Theoretical pI: | 8.973 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
Instability index: | 37.023 | ||
aromaticity | 0.142 | ||
GRAVY | -0.121 | ||
Secondary Structure Fraction | |||
Helix | 0.363 | ||
turn | 0.301 | ||
sheet | 0.204 |