Acc_NO	ORF type	length	start-end position (strand +/-)
>FG356301.1	complete	133	36-437(+)
Amino Acid sequence :
MASSKFCGIILVIAILFHSTFSSACGTCQTKPKPKPPSSSPSPSPSPVGHCPKDALKLGACVNLLGLVNVPMGTPISSKCRALLDGLADLEAALGLCTAIKANVLGLNLNVPVTLSLLIS ACQKSVPPGFQCE*
Physicochemical properties
Number of amino acids:		133
Molecular weight:		13,556.992
Theoretical pI:		8.800
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 500
Instability index:		53.953
aromaticity		0.030
GRAVY		0.494
Secondary Structure Fraction
Helix		0.293
turn		0.338
sheet		0.263