Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356301.1 | complete | 133 | 36-437(+) |
Amino Acid sequence : | |||
MASSKFCGIILVIAILFHSTFSSACGTCQTKPKPKPPSSSPSPSPSPVGHCPKDALKLGACVNLLGLVNVPMGTPISSKCRALLDGLADLEAALGLCTAIKANVLGLNLNVPVTLSLLIS ACQKSVPPGFQCE* | |||
Physicochemical properties | |||
Number of amino acids: | 133 | ||
Molecular weight: | 13,556.992 | ||
Theoretical pI: | 8.800 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 500 | ||
Instability index: | 53.953 | ||
aromaticity | 0.030 | ||
GRAVY | 0.494 | ||
Secondary Structure Fraction | |||
Helix | 0.293 | ||
turn | 0.338 | ||
sheet | 0.263 |