Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356307.1 | internal | 113 | 1-339(+) |
Amino Acid sequence : | |||
TDICRESALRPGGKYIVREVRMVMDRNDEELYGLREMMDPTIRNSSTYLVGFGRFLELAMQCLEESAVDRPTMSEVVKAIESILQNDGLNTNSTSASSSGTDFGTSKGGPRHP | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 12,445.314 | ||
Theoretical pI: | 8.914 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 55.308 | ||
aromaticity | 0.088 | ||
GRAVY | 0.065 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.327 | ||
sheet | 0.230 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356307.1 | internal | 113 | 341-3(-) |
Amino Acid sequence : | |||
YGCLGPPLEVPKSVPEEDAEVELVFKPSFCKMLSIAFTTSLMVGRSTADSSRHCMANSKNLPNPTRYVLLFLIVGSIISLKPYNSSSFLSITILTSRTIYFPPGRNADSRHMS | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 12,445.314 | ||
Theoretical pI: | 8.914 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 55.308 | ||
aromaticity | 0.088 | ||
GRAVY | 0.065 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.327 | ||
sheet | 0.230 |