Acc_NO	ORF type	length	start-end position (strand +/-)
>FG356314.1	complete	112	39-377(+)
Amino Acid sequence :
MSPKYLLFLLIAVVVLTTYSSLVDADVDGYKYKRPHYPPKHYPPKKHYPPTEEEESSTTGIVDEEKASTTTEEDAKDYYKKRPPYYKPPHYKPPHYKPPHYKPPHYKPPTAN*
Physicochemical properties
Number of amino acids:		112
Molecular weight:		13,120.695
Theoretical pI:		8.859
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22350 22350
Instability index:		89.155
aromaticity		0.143
GRAVY		-1.206
Secondary Structure Fraction
Helix		0.268
turn		0.259
sheet		0.179