Acc_NO	ORF type	length	start-end position (strand +/-)
>FG356343.1	complete	133	48-449(+)
Amino Acid sequence :
MASSKFCGIILVIAILFHSTFSSACGTCQTKPKPKPPSSSPSPSPSPVAHCPKDALKLGACVNLLGLFNVPIGTPISSKCYALLDGLADLEAALCLCTAIKANVLGLNLNVPVTLSLLIS ACQKSVPPGFQCG*
Physicochemical properties
Number of amino acids:		133
Molecular weight:		13,582.039
Theoretical pI:		8.733
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 2115
Instability index:		57.749
aromaticity		0.045
GRAVY		0.589
Secondary Structure Fraction
Helix		0.308
turn		0.331
sheet		0.256