Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356353.1 | 5prime_partial | 107 | 2-325(+) |
Amino Acid sequence : | |||
TAGATLEALSLGVPMVAVPQWSDQTTNSKLVMDVWKVGVTAKLHNTEMVTRDELAQCIGKVMGGDEGLEFKRNSNKWKQLAREAVDEGGSSDKSIEEFVDTLAAPDG* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 11,507.831 | ||
Theoretical pI: | 4.664 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 23.136 | ||
aromaticity | 0.047 | ||
GRAVY | -0.327 | ||
Secondary Structure Fraction | |||
Helix | 0.252 | ||
turn | 0.224 | ||
sheet | 0.299 |