Acc_NO	ORF type	length	start-end position (strand +/-)
>FG356366.1	5prime_partial	99	335-36(-)
Amino Acid sequence :
SSGTVQFLKWARATSRWYSLAAKLKSTALIFSPATYGPCALRCSSNAFNSVSKACSDPSSGFLLFRKVTKVENIFDPAEANSGGVLREGIGYLSSRIPT*
Physicochemical properties
Number of amino acids:		99
Molecular weight:		10,613.987
Theoretical pI:		9.781
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15470 15595
Instability index:		40.985
aromaticity		0.111
GRAVY		-0.016
Secondary Structure Fraction
Helix		0.293
turn		0.323
sheet		0.232