Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356366.1 | 5prime_partial | 99 | 335-36(-) |
Amino Acid sequence : | |||
SSGTVQFLKWARATSRWYSLAAKLKSTALIFSPATYGPCALRCSSNAFNSVSKACSDPSSGFLLFRKVTKVENIFDPAEANSGGVLREGIGYLSSRIPT* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 10,613.987 | ||
Theoretical pI: | 9.781 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
Instability index: | 40.985 | ||
aromaticity | 0.111 | ||
GRAVY | -0.016 | ||
Secondary Structure Fraction | |||
Helix | 0.293 | ||
turn | 0.323 | ||
sheet | 0.232 |