Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356367.1 | 3prime_partial | 101 | 81-383(+) |
Amino Acid sequence : | |||
MVRVSVLNDALKCMYNAEKRGKRQVLIRPSSKVIIKFLIVMQKHGYIGEFEYVDDHRSGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGY | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 11,596.522 | ||
Theoretical pI: | 9.824 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 37.335 | ||
aromaticity | 0.089 | ||
GRAVY | -0.172 | ||
Secondary Structure Fraction | |||
Helix | 0.366 | ||
turn | 0.218 | ||
sheet | 0.198 |