Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356393.1 | internal | 120 | 3-362(+) |
Amino Acid sequence : | |||
QVLNDSSGSSLPAGPVLNDKPYFNEAGYDRQMGRDEGEKNSVSYNENAFLMTCKLMLYLLLKPPKHFEALVEEHFSRRSQCIIMACKAYMEGAPVGHAVDCGRSEKEYRRGNSNGCKIML | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 13,455.219 | ||
Theoretical pI: | 6.993 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9190 | ||
Instability index: | 44.045 | ||
aromaticity | 0.083 | ||
GRAVY | -0.528 | ||
Secondary Structure Fraction | |||
Helix | 0.250 | ||
turn | 0.283 | ||
sheet | 0.292 |