Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356401.1 | complete | 165 | 82-579(+) |
Amino Acid sequence : | |||
MALRTWASSTANALRLSCASRASLSPAFALSKCFSTVLDGLKYASSHEWVKHEGSVATIGITHHAQDHLGEVVFVELPESGGSVSQGSSFGAVESVKATSDVNSPISGQVAEVNSKLSES PGLINSSPYEEGWMITVKPNNPSELESLMGPKEYTKFCEEEDASH* | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 17,517.240 | ||
Theoretical pI: | 5.046 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
Instability index: | 48.494 | ||
aromaticity | 0.067 | ||
GRAVY | -0.224 | ||
Secondary Structure Fraction | |||
Helix | 0.255 | ||
turn | 0.327 | ||
sheet | 0.285 |