Acc_NO	ORF type	length	start-end position (strand +/-)
>FG356401.1	complete	165	82-579(+)
Amino Acid sequence :
MALRTWASSTANALRLSCASRASLSPAFALSKCFSTVLDGLKYASSHEWVKHEGSVATIGITHHAQDHLGEVVFVELPESGGSVSQGSSFGAVESVKATSDVNSPISGQVAEVNSKLSES PGLINSSPYEEGWMITVKPNNPSELESLMGPKEYTKFCEEEDASH*
Physicochemical properties
Number of amino acids:		165
Molecular weight:		17,517.240
Theoretical pI:		5.046
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20970 21095
Instability index:		48.494
aromaticity		0.067
GRAVY		-0.224
Secondary Structure Fraction
Helix		0.255
turn		0.327
sheet		0.285