Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356420.1 | complete | 119 | 48-407(+) |
Amino Acid sequence : | |||
MASSKFCGIILVIAILFHSTFSSACGTCQTKPKPKPPSSSPSPSPSPVAHCPKDALKLGACVNLLGLVNVPIGTPISSKCCPLLDGLADLEAALCLCTAIKATVLGLNLNVPVTSQFAN* | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 12,104.271 | ||
Theoretical pI: | 8.632 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 500 | ||
Instability index: | 58.318 | ||
aromaticity | 0.034 | ||
GRAVY | 0.566 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.328 | ||
sheet | 0.252 |