Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356431.1 | 5prime_partial | 111 | 1-336(+) |
Amino Acid sequence : | |||
SVVVYFCCFMMGFGPIPNILCSEIFPTRVRGQCIAICALVFRFGDITVTYTLPVMLKSIGLAGVFGMYAIVCMISFVFVYIKVPETKGMPLEVITEFFSVGSKHVEAGKNN* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 12,221.631 | ||
Theoretical pI: | 8.245 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
Instability index: | 30.272 | ||
aromaticity | 0.135 | ||
GRAVY | 0.923 | ||
Secondary Structure Fraction | |||
Helix | 0.423 | ||
turn | 0.225 | ||
sheet | 0.198 |