Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356449.1 | 5prime_partial | 188 | 1-567(+) |
Amino Acid sequence : | |||
NMRSNVDMAKHLDNMKTELSEKCGSEEYCKDMFSLLVETMEMAIKSWHETTKVDPRVYFLLDKEKTQTDKYSPAVNIDKAFESPHTHSNCFSFLRQYAEDSFSRAACLVTPKCVISFPQV WRGQGSRKWSHGQHDGFFVRFESPFLRKLWFIPSSNEQGQTLCRKPEVIDIGAHELLPRLYKEQKSNP* | |||
Physicochemical properties | |||
Number of amino acids: | 188 | ||
Molecular weight: | 12,670.467 | ||
Theoretical pI: | 6.796 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
Instability index: | 43.915 | ||
aromaticity | 0.114 | ||
GRAVY | 0.182 | ||
Secondary Structure Fraction | |||
Helix | 0.316 | ||
turn | 0.237 | ||
sheet | 0.246 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356449.1 | 3prime_partial | 114 | 344-3(-) |
Amino Acid sequence : | |||
MTHFGVTKQAALEKESSAYCLRNEKQLLCVCGDSKALSIFTAGEYLSVCVFSLSRRKYTLGSTFVVSCHDFIAISIVSTSKENMSLQYSSDPHFSDNSVFMLSKCFAMSTFDLM | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 12,670.467 | ||
Theoretical pI: | 6.796 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
Instability index: | 43.915 | ||
aromaticity | 0.114 | ||
GRAVY | 0.182 | ||
Secondary Structure Fraction | |||
Helix | 0.316 | ||
turn | 0.237 | ||
sheet | 0.246 |