Acc_NO	ORF type	length	start-end position (strand +/-)
>FG356463.1	internal	127	1-381(+)
Amino Acid sequence :
SQQLQYFKEYHTKLAKVSGDKKASSIIKEALYILSSGSSDFLQNYYVNPLINRAYTPDQYGSYLVGRFSSFAKDLYGLGARRVGVTSLPPLGCLPAAITLFGFHEQGCVPRINNVAQGFN KKMNSTV
Physicochemical properties
Number of amino acids:		127
Molecular weight:		14,036.868
Theoretical pI:		9.517
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		13410 13535
Instability index:		34.252
aromaticity		0.126
GRAVY		-0.192
Secondary Structure Fraction
Helix		0.339
turn		0.291
sheet		0.205