Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356469.1 | internal | 102 | 2-307(+) |
Amino Acid sequence : | |||
DKFLFQINRKLNELAKEVYAGDKNAHVALGMLDMKHMQTKLHKYYRYVGSLTTPPCTEQVIWNVLVKVRSISKEQVVALETPFERNLSRKFEAGAAAQWATG | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,668.384 | ||
Theoretical pI: | 9.480 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
Instability index: | 21.668 | ||
aromaticity | 0.098 | ||
GRAVY | -0.349 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.167 | ||
sheet | 0.294 |