Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356488.1 | 5prime_partial | 124 | 3-377(+) |
Amino Acid sequence : | |||
KSLRIYSLCRRRRRNDRDREIGEASHMAMNNGLRSAAKQLITSSESIISTKTGIKGFHSTGVKRMGGGHGHDGPFYLHAKHMYNLDRMKYQKIKMPLAVFTAFSIGVAVPVYAVIFQQRK TVSG* | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 13,940.050 | ||
Theoretical pI: | 10.691 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
Instability index: | 58.496 | ||
aromaticity | 0.081 | ||
GRAVY | -0.429 | ||
Secondary Structure Fraction | |||
Helix | 0.266 | ||
turn | 0.242 | ||
sheet | 0.202 |