Acc_NO	ORF type	length	start-end position (strand +/-)
>FG356531.1	internal	99	3-299(+)
Amino Acid sequence :
SMNHDTQSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIDNVPGMKALDMNSAEDAIVKLTRGVVPGMIVTGMEVAEIDGAPKNGNYIWSHDDI
Physicochemical properties
Number of amino acids:		99
Molecular weight:		10,474.896
Theoretical pI:		4.892
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 7115
Instability index:		26.457
aromaticity		0.030
GRAVY		-0.104
Secondary Structure Fraction
Helix		0.242
turn		0.293
sheet		0.222