Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356547.1 | internal | 196 | 3-590(+) |
Amino Acid sequence : | |||
XTQILKALSLGLGLEEGRLEEEVGGMEELLLQMKINYYPKCPQPELALGVEAHTDVSALSFLLHNMVPGLQLFYEGKWITAKCVPNSIIMHIGDTIEILSNGKYKSILHRGLVNKEKVRI SWAVFCEPPKEKIILQPLPQLVSEVEPPLFPPRTFAQHIQHKLFQKTHEDMLDKSVEFQDYYSCYNLALLLFCCCV | |||
Physicochemical properties | |||
Number of amino acids: | 196 | ||
Molecular weight: | 22,210.818 | ||
Theoretical pI: | 5.797 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21805 | ||
Instability index: | 54.699 | ||
aromaticity | 0.087 | ||
GRAVY | 0.016 | ||
Secondary Structure Fraction | |||
Helix | 0.364 | ||
turn | 0.205 | ||
sheet | 0.308 |