Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356582.1 | complete | 116 | 61-411(+) |
Amino Acid sequence : | |||
MRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKNGKKVSKAPKIQRLVTPLTLQRKRARIAEKKSRVAKAKSEAAEYQKLLATRLKEQRERRSESLAKKRSRLPAASKPSVAA* | |||
Physicochemical properties | |||
Number of amino acids: | 116 | ||
Molecular weight: | 13,379.583 | ||
Theoretical pI: | 11.570 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 46.562 | ||
aromaticity | 0.043 | ||
GRAVY | -1.092 | ||
Secondary Structure Fraction | |||
Helix | 0.207 | ||
turn | 0.172 | ||
sheet | 0.276 |