Acc_NO	ORF type	length	start-end position (strand +/-)
>FG356618.1	complete	133	49-450(+)
Amino Acid sequence :
MASSKFCGIILVIAILFHSTFSSACGTCQSKPKPKPPSSSPSPSPSPVAHSPKDALKLGACVNLLGLVNVPIGTPISSKCCAWLDGLADLEAALCLGTAIKANVLGLNLNVPVTLSLLIS ACQKSVPPGFQCE*
Physicochemical properties
Number of amino acids:		133
Molecular weight:		13,542.897
Theoretical pI:		8.624
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 6000
Instability index:		58.966
aromaticity		0.038
GRAVY		0.522
Secondary Structure Fraction
Helix		0.301
turn		0.346
sheet		0.256