Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356618.1 | complete | 133 | 49-450(+) |
Amino Acid sequence : | |||
MASSKFCGIILVIAILFHSTFSSACGTCQSKPKPKPPSSSPSPSPSPVAHSPKDALKLGACVNLLGLVNVPIGTPISSKCCAWLDGLADLEAALCLGTAIKANVLGLNLNVPVTLSLLIS ACQKSVPPGFQCE* | |||
Physicochemical properties | |||
Number of amino acids: | 133 | ||
Molecular weight: | 13,542.897 | ||
Theoretical pI: | 8.624 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 6000 | ||
Instability index: | 58.966 | ||
aromaticity | 0.038 | ||
GRAVY | 0.522 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.346 | ||
sheet | 0.256 |