Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356636.1 | complete | 126 | 49-429(+) |
Amino Acid sequence : | |||
MPQKCMKSGYSYIEGVEEXLYSLRQNNYEMHAFTNYPAWYQIIEDKLNVSRYLSWTFCSCINGKRKPDPDSYLDVLKHLEVDPADCIFIDDRKKNVEAAVEVGIVGLRFKNADKLREDLS LAGIDV* | |||
Physicochemical properties | |||
Number of amino acids: | 126 | ||
Molecular weight: | 14,461.313 | ||
Theoretical pI: | 5.161 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23170 | ||
Instability index: | 35.263 | ||
aromaticity | 0.112 | ||
GRAVY | -0.422 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.208 | ||
sheet | 0.240 |