Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356666.1 | 5prime_partial | 151 | 2-457(+) |
Amino Acid sequence : | |||
LLIQANMASIVASLPPPFLVCGRSTLFTALPKLPLSTFRERQNHASFVAKATGGRSESSTSLSIVESVQNVWDKSEDRVALIGLGFAAIVALWASTNLITAIDRLPVVPGLLELIGILFS TWFVYRYLLFKPDREEVFQIINKSISEILGQ* | |||
Physicochemical properties | |||
Number of amino acids: | 151 | ||
Molecular weight: | 16,590.145 | ||
Theoretical pI: | 8.113 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
Instability index: | 36.478 | ||
aromaticity | 0.093 | ||
GRAVY | 0.439 | ||
Secondary Structure Fraction | |||
Helix | 0.397 | ||
turn | 0.245 | ||
sheet | 0.285 |