Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356694.1 | 5prime_partial | 179 | 3-542(+) |
Amino Acid sequence : | |||
TDLKALSLGLGLEEGRLEEEVGGMEELLLQMKINYYPKCPQPELALGVEAHTDVSALSFLLHNMVPGLQLFYEGKWITTKCVPNSIIMHIGDTIEILSNGKYKSILHRGLVNKEKVRISW AVFCEPPKEKIILQPLPQLVSEVEPPLFPPRTFAQHIQHKLFQKTHEDMLDKSVEFQDY* | |||
Physicochemical properties | |||
Number of amino acids: | 179 | ||
Molecular weight: | 20,404.533 | ||
Theoretical pI: | 5.638 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
Instability index: | 55.950 | ||
aromaticity | 0.078 | ||
GRAVY | -0.173 | ||
Secondary Structure Fraction | |||
Helix | 0.346 | ||
turn | 0.212 | ||
sheet | 0.302 |