Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356709.1 | 5prime_partial | 119 | 2-361(+) |
Amino Acid sequence : | |||
TMGYVQSTNVCERADGNPTMILSENGMDDPGNVTLPQGLHDTTRVNFYKSYLTQLKKAVDDGANVAGYFAWSLLVNFEWKSGYTSRFGIVYVDYKDNLKRYPKMSAKWFQKLLTRNKKQ* | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 13,647.337 | ||
Theoretical pI: | 9.325 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28420 | ||
Instability index: | 17.427 | ||
aromaticity | 0.134 | ||
GRAVY | -0.600 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.244 | ||
sheet | 0.193 |