Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356712.1 | complete | 136 | 84-494(+) |
Amino Acid sequence : | |||
MDSRKEPFATPKLASHTLELPLKSSNEIDVIFATKKRKKRDPEKTNQSNKDATVKPNKQTKNKKKKDKVFKDDDVPGRKKNNKVFKDYDVPVSQISKPRRKKMNDGLTVYTEEELGINKS DAGGTPLCPFDCECCF* | |||
Physicochemical properties | |||
Number of amino acids: | 136 | ||
Molecular weight: | 15,505.594 | ||
Theoretical pI: | 9.516 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 55.842 | ||
aromaticity | 0.059 | ||
GRAVY | -1.196 | ||
Secondary Structure Fraction | |||
Helix | 0.199 | ||
turn | 0.235 | ||
sheet | 0.162 |