Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356713.1 | internal | 99 | 1-297(+) |
Amino Acid sequence : | |||
FPTKLREKRIKKWQVELQRTFSPLATSFVNTRNSKKRSTNYNNVHYITGMNSFAGLRAQNNTVAAWGLPMCTERSFAKIVSSLRSFPTKGQKGGGALSS | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,098.596 | ||
Theoretical pI: | 11.353 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 55.093 | ||
aromaticity | 0.101 | ||
GRAVY | -0.593 | ||
Secondary Structure Fraction | |||
Helix | 0.253 | ||
turn | 0.303 | ||
sheet | 0.192 |