Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356718.1 | 5prime_partial | 127 | 2-385(+) |
Amino Acid sequence : | |||
ERYYSDHTHMCYSNFNDIIHSIINMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALQNMVAAAKLLR TQLASAK* | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 11,143.948 | ||
Theoretical pI: | 8.977 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 56.023 | ||
aromaticity | 0.100 | ||
GRAVY | 0.370 | ||
Secondary Structure Fraction | |||
Helix | 0.370 | ||
turn | 0.280 | ||
sheet | 0.260 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356718.1 | complete | 100 | 336-34(-) |
Amino Acid sequence : | |||
MFCNAGLTSVYLRVLRPQSGLTHKIFVSRTASILLILSAISSVDGILGEWMSYTPGPIPAPYFTPSRKTERSFSSEREFSIVITSASMLIIEWIMSLKLE* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,143.948 | ||
Theoretical pI: | 8.977 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 56.023 | ||
aromaticity | 0.100 | ||
GRAVY | 0.370 | ||
Secondary Structure Fraction | |||
Helix | 0.370 | ||
turn | 0.280 | ||
sheet | 0.260 |