Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356734.1 | 3prime_partial | 100 | 31-330(+) |
Amino Acid sequence : | |||
MGEFKHWVVVKFKEDVVVEEILKGLENLVSEVDSVKSFEWGQDIERLEMLRQGFTHAFLMTFNKKEDYTAFQSHSKHVEFSATFSTAIEKIVVLDFPALV | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,613.176 | ||
Theoretical pI: | 5.126 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
Instability index: | 37.561 | ||
aromaticity | 0.130 | ||
GRAVY | -0.036 | ||
Secondary Structure Fraction | |||
Helix | 0.380 | ||
turn | 0.140 | ||
sheet | 0.280 |