Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356764.1 | 5prime_partial | 142 | 2-430(+) |
Amino Acid sequence : | |||
GFYTYDDKRKAKPDPELKKYIEKSRNISGVAMDPKLVKLSEKDIVEMIFFPVVNEACRVLDEGIAVKSADLDISSVMGMGFPPYRGGLIFWADSLGSKYIFSRLEQWSNTYGEFFKPCGY LAERAAKDAPLGSTGKQAKSRL* | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 15,903.134 | ||
Theoretical pI: | 8.791 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21555 | ||
Instability index: | 31.038 | ||
aromaticity | 0.120 | ||
GRAVY | -0.338 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.246 | ||
sheet | 0.246 |