Acc_NO	ORF type	length	start-end position (strand +/-)
>FG356782.1	complete	133	47-448(+)
Amino Acid sequence :
MASSKFCGIILVIAILFHSTFSSACGTCQTKPKPKPPSSSPSPSPSPVAHCPKDALKLGACVNLLGLVNVPIGTPISSKCCALLDGLADLEAALCLCTAIKANVLGLNLNVPVTLSLLIS ACQKSVPPGFQCE*
Physicochemical properties
Number of amino acids:		133
Molecular weight:		11,128.630
Theoretical pI:		10.798
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		13980 13980
Instability index:		34.523
aromaticity		0.140
GRAVY		-0.156
Secondary Structure Fraction
Helix		0.320
turn		0.290
sheet		0.200

Acc_NO	ORF type	length	start-end position (strand +/-)
>FG356782.1	5prime_partial	100	495-193(-)
Amino Acid sequence :
FFFFFNNYLFPQIKSHYSHWKPGGTDFWQALISKLRVTGTFKLSPSTLALIAVQRQRAASKSANPSSKAQHLLEIGVPIGTLTSPSRFTQAPNFKASLGQ*
Physicochemical properties
Number of amino acids:		100
Molecular weight:		11,128.630
Theoretical pI:		10.798
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		13980 13980
Instability index:		34.523
aromaticity		0.140
GRAVY		-0.156
Secondary Structure Fraction
Helix		0.320
turn		0.290
sheet		0.200