Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356793.1 | 5prime_partial | 127 | 3-386(+) |
Amino Acid sequence : | |||
IEETLAMSWKSRSVVAASKSVVSRKWTLLLCIGCFCVGMLFSDRMWTMPEVQIIPRRIVAEEKELKSILGCVIASKGVENENXDVYGEVYKTHHAIHTLDKTISNFRDGISCCKGCTGIY PCRFSDG* | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 14,095.321 | ||
Theoretical pI: | 8.167 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21470 | ||
Instability index: | 30.758 | ||
aromaticity | 0.079 | ||
GRAVY | 0.056 | ||
Secondary Structure Fraction | |||
Helix | 0.317 | ||
turn | 0.214 | ||
sheet | 0.214 |