Acc_NO	ORF type	length	start-end position (strand +/-)
>FG356803.1	complete	133	48-449(+)
Amino Acid sequence :
MASSKFCGIILVIAILFHSTFSSACGTCQTKPKPKPPSSSPSASPSPVAHCPKDALKLGACVNLLGLVNVPIRTPISSKCSAWLDGLADLEAALCLCTAIKANVLGLNLNVPVTLSLLIS ACQKSVPPGFQCE*
Physicochemical properties
Number of amino acids:		133
Molecular weight:		13,676.113
Theoretical pI:		8.741
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 6125
Instability index:		52.783
aromaticity		0.038
GRAVY		0.539
Secondary Structure Fraction
Helix		0.301
turn		0.316
sheet		0.263