Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356812.1 | internal | 99 | 2-298(+) |
Amino Acid sequence : | |||
RPDRKGLAPIFIDHEKGRTSGFEEAVRRVMLKTNFGGPHKRISPESFYTNSWPECFCKTSTQNPAHKCPSDNILEILDSQLGNDATDDAESSTLSNSTR | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,055.108 | ||
Theoretical pI: | 6.322 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 61.435 | ||
aromaticity | 0.071 | ||
GRAVY | -0.865 | ||
Secondary Structure Fraction | |||
Helix | 0.202 | ||
turn | 0.303 | ||
sheet | 0.192 |