Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356859.1 | 5prime_partial | 146 | 1-441(+) |
Amino Acid sequence : | |||
IKAAKFVDKNLQPSRIRGLILHQPFFGGSQRTESELRLQNDPILPLSATDLMWSLALPVGADRDHEYCNPMVGSDSKIFETIKSLGWRVLVTACGGDLLYDRQIELVKMMEDKGVKMVSH LEKGGTHGPERLHPLHQVLKNFIYAS* | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 16,408.827 | ||
Theoretical pI: | 7.991 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
Instability index: | 41.899 | ||
aromaticity | 0.068 | ||
GRAVY | -0.249 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.233 | ||
sheet | 0.267 |