Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356867.1 | complete | 123 | 40-411(+) |
Amino Acid sequence : | |||
MASILSTSGIGLVSYRNPDMEGSNMSQIGIRRYPLFSTHRIVLHGKRARSLMMVKAEGQSINPEIRKSEDKVVDSVVVTELSKPLTAYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLL KKQ* | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 13,599.634 | ||
Theoretical pI: | 9.762 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 44.689 | ||
aromaticity | 0.049 | ||
GRAVY | -0.311 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.285 | ||
sheet | 0.211 |