Acc_NO	ORF type	length	start-end position (strand +/-)
>FG356884.1	5prime_partial	126	3-383(+)
Amino Acid sequence :
RAYYIFASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGSVGFRAALLFVRHIY RSIKCE*
Physicochemical properties
Number of amino acids:		126
Molecular weight:		14,911.414
Theoretical pI:		8.621
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		42860 43110
Instability index:		41.589
aromaticity		0.262
GRAVY		0.833
Secondary Structure Fraction
Helix		0.508
turn		0.143
sheet		0.238