Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356884.1 | 5prime_partial | 126 | 3-383(+) |
Amino Acid sequence : | |||
RAYYIFASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGSVGFRAALLFVRHIY RSIKCE* | |||
Physicochemical properties | |||
Number of amino acids: | 126 | ||
Molecular weight: | 14,911.414 | ||
Theoretical pI: | 8.621 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42860 43110 | ||
Instability index: | 41.589 | ||
aromaticity | 0.262 | ||
GRAVY | 0.833 | ||
Secondary Structure Fraction | |||
Helix | 0.508 | ||
turn | 0.143 | ||
sheet | 0.238 |