Acc_NO	ORF type	length	start-end position (strand +/-)
>FG356903.1	complete	107	33-356(+)
Amino Acid sequence :
MSPKYLLFLLIAVVVLTTYSSLVDADVDGYKYKRPHYPPKHYPPKKHYPPTEEEESSTTGIVDEEKASTTAEEDAKDYYKKRPPYYKPPHYKPPHYKPPHYKPPTAN*
Physicochemical properties
Number of amino acids:		107
Molecular weight:		12,467.954
Theoretical pI:		8.586
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20860 20860
Instability index:		85.852
aromaticity		0.140
GRAVY		-1.131
Secondary Structure Fraction
Helix		0.271
turn		0.252
sheet		0.196