Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356903.1 | complete | 107 | 33-356(+) |
Amino Acid sequence : | |||
MSPKYLLFLLIAVVVLTTYSSLVDADVDGYKYKRPHYPPKHYPPKKHYPPTEEEESSTTGIVDEEKASTTAEEDAKDYYKKRPPYYKPPHYKPPHYKPPHYKPPTAN* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 12,467.954 | ||
Theoretical pI: | 8.586 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20860 20860 | ||
Instability index: | 85.852 | ||
aromaticity | 0.140 | ||
GRAVY | -1.131 | ||
Secondary Structure Fraction | |||
Helix | 0.271 | ||
turn | 0.252 | ||
sheet | 0.196 |