Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356912.1 | 5prime_partial | 146 | 1-441(+) |
Amino Acid sequence : | |||
LIYVNEQYDGWKAECLRMLQQRFDHNTRSFAPNVDGEILEAVQNTPVRPDDNFKKTQKICMPFLRFKKDEAVAIGVQALDLKLAFGEIAVLQENLDLTKRQIGLEEVEVLSITNPDAHTK AGSFVKLIEQNPPSPGNPTAIFLTRS* | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 16,468.631 | ||
Theoretical pI: | 5.421 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 52.310 | ||
aromaticity | 0.075 | ||
GRAVY | -0.340 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.205 | ||
sheet | 0.267 |