Acc_NO	ORF type	length	start-end position (strand +/-)
>FG356917.1	complete	118	34-390(+)
Amino Acid sequence :
MASSKFCGIILVIAILFHSTFSSACGTCQTKPKPKPPSSSPSPSPSPVAHCPKDALKLGACVNLLGLVNVPIGTPISSKCCALLDGLADLEAALCLCTAIKANVLGLNLNVPVTLSLL*
Physicochemical properties
Number of amino acids:		118
Molecular weight:		11,970.222
Theoretical pI:		8.632
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 500
Instability index:		56.102
aromaticity		0.025
GRAVY		0.692
Secondary Structure Fraction
Helix		0.314
turn		0.322
sheet		0.280