Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356917.1 | complete | 118 | 34-390(+) |
Amino Acid sequence : | |||
MASSKFCGIILVIAILFHSTFSSACGTCQTKPKPKPPSSSPSPSPSPVAHCPKDALKLGACVNLLGLVNVPIGTPISSKCCALLDGLADLEAALCLCTAIKANVLGLNLNVPVTLSLL* | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 11,970.222 | ||
Theoretical pI: | 8.632 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 500 | ||
Instability index: | 56.102 | ||
aromaticity | 0.025 | ||
GRAVY | 0.692 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.322 | ||
sheet | 0.280 |