Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356927.1 | complete | 113 | 30-371(+) |
Amino Acid sequence : | |||
MSPKYLLFLLIAVVVLTTYSSLVGADVDGYKYKRPHYPPKHYPPKKHYPPTEEEESSTTGIVDEEKASTTAEEDAKDYYKKRPPYYKPPHYKPPHYHKPPYHKPPHYKPPTPN* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 13,195.809 | ||
Theoretical pI: | 9.048 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22350 22350 | ||
Instability index: | 89.065 | ||
aromaticity | 0.142 | ||
GRAVY | -1.204 | ||
Secondary Structure Fraction | |||
Helix | 0.265 | ||
turn | 0.274 | ||
sheet | 0.177 |