Acc_NO	ORF type	length	start-end position (strand +/-)
>FG356927.1	complete	113	30-371(+)
Amino Acid sequence :
MSPKYLLFLLIAVVVLTTYSSLVGADVDGYKYKRPHYPPKHYPPKKHYPPTEEEESSTTGIVDEEKASTTAEEDAKDYYKKRPPYYKPPHYKPPHYHKPPYHKPPHYKPPTPN*
Physicochemical properties
Number of amino acids:		113
Molecular weight:		13,195.809
Theoretical pI:		9.048
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22350 22350
Instability index:		89.065
aromaticity		0.142
GRAVY		-1.204
Secondary Structure Fraction
Helix		0.265
turn		0.274
sheet		0.177