Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356943.1 | 5prime_partial | 171 | 3-518(+) |
Amino Acid sequence : | |||
SQVDMLTQLSPWMALGGQITIITGIFYWIAQLIGSIVACSLLKFVTGGLAIPTHSVAAGVGSIEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMN PARSFGPAVVSGDFHDNWIYWVGPLVGGGLAGLIYGNVFIHSDHQPLSSDF* | |||
Physicochemical properties | |||
Number of amino acids: | 171 | ||
Molecular weight: | 17,652.292 | ||
Theoretical pI: | 5.250 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29450 | ||
Instability index: | 28.093 | ||
aromaticity | 0.105 | ||
GRAVY | 0.782 | ||
Secondary Structure Fraction | |||
Helix | 0.392 | ||
turn | 0.298 | ||
sheet | 0.222 |