Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356954.1 | complete | 153 | 125-586(+) |
Amino Acid sequence : | |||
MAPKADISKKTDPKAQTLKTAKAAKSGPTFKKAAKKIRTKVTFHRPKTLKKDRNPKYPRISAPPRNKLDHYQILKYPLTTESAMKKIEDNNTLVFIVDIRADKKKIKDAVKKMYDIQTKK VNTLIRPDGTKKAYVRLTPDYDALDVANKIGII* | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 17,405.374 | ||
Theoretical pI: | 10.209 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 8940 | ||
Instability index: | 26.620 | ||
aromaticity | 0.059 | ||
GRAVY | -0.808 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.157 | ||
sheet | 0.190 |