Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG356976.1 | 5prime_partial | 128 | 2-388(+) |
Amino Acid sequence : | |||
WSTARVFLITPPPIDEEGRLRHPYMDNPLNEPERTNEAAGAYAKACISVANECGIPVVDLWTKMQQIPNWKSALLSDGLHLTPSGNRVVYEEVIMKLKDEGISVDTMPVDLPLITEIDPN DPLKVSQQ* | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 14,265.127 | ||
Theoretical pI: | 4.613 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
Instability index: | 41.588 | ||
aromaticity | 0.055 | ||
GRAVY | -0.310 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.258 | ||
sheet | 0.266 |