Acc_NO	ORF type	length	start-end position (strand +/-)
>FG356981.1	complete	112	33-371(+)
Amino Acid sequence :
MSPKYLLFLLIAVVVLTTYSSLVDADVDGYKYKRPHYPPKHYPPKKHYPPTEEEESSTTGIVDEDKASTTAEEDAKDYYKKRPPYYKPPHYKPXHYKPXHYKPPXYKPPTAN*
Physicochemical properties
Number of amino acids:		112
Molecular weight:		12,745.273
Theoretical pI:		8.859
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22350 22350
Instability index:		79.999
aromaticity		0.147
GRAVY		-1.158
Secondary Structure Fraction
Helix		0.275
turn		0.248
sheet		0.183