Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG357053.1 | complete | 119 | 170-529(+) |
Amino Acid sequence : | |||
MLGGSLGEKAAEDLKLRIIEHNILVVSKYYSRITLKRLAELLCLSIQEAEKHLSDMVVSKALVAKIDRPLGVVCFQTSKDSNDILNSWSMNLEKLLDLVEKSCHQIHKETMVHKAALKA* | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 13,355.603 | ||
Theoretical pI: | 8.441 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 42.985 | ||
aromaticity | 0.034 | ||
GRAVY | 0.007 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.168 | ||
sheet | 0.345 |