Acc_NO	ORF type	length	start-end position (strand +/-)
>FG357073.1	5prime_partial	113	2-343(+)
Amino Acid sequence :
HFLYPLNPAASPVGGHSTPSNMTKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES*
Physicochemical properties
Number of amino acids:		113
Molecular weight:		12,402.257
Theoretical pI:		10.187
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		14440 14690
Instability index:		36.419
aromaticity		0.088
GRAVY		-0.542
Secondary Structure Fraction
Helix		0.239
turn		0.248
sheet		0.186