Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG357082.1 | internal | 103 | 3-311(+) |
Amino Acid sequence : | |||
LYDNPIFQSQGLVKMAETKPSLRKPVFTKVDQLRPGTSGHTLTLKVVSTKMVLQKGRADGPQVRQMRIAESLVGDETGMIIFTARNDQVDLMKEGSTAVLRNA | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 11,357.069 | ||
Theoretical pI: | 9.893 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 33.792 | ||
aromaticity | 0.039 | ||
GRAVY | -0.318 | ||
Secondary Structure Fraction | |||
Helix | 0.272 | ||
turn | 0.214 | ||
sheet | 0.243 |