Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>FG357089.1 | 3prime_partial | 170 | 5-514(+) |
Amino Acid sequence : | |||
MQKRKSTKKFLVSLFLVFIFAPFITKSEELDCVYTIYVRTENVGYGGTDSNIGIRLLNKYGDGYLIENLVTWGGLMGDDHDYFEKGNLDIFSGRGVCLNAPVCSVLITSDNTGDLPGWYV EYVEITTAGLHVPAESIQFKLNQWLAVDEPPFELTAYRDYCPATTYSQYP | |||
Physicochemical properties | |||
Number of amino acids: | 170 | ||
Molecular weight: | 19,169.517 | ||
Theoretical pI: | 4.656 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34380 34630 | ||
Instability index: | 31.085 | ||
aromaticity | 0.141 | ||
GRAVY | -0.078 | ||
Secondary Structure Fraction | |||
Helix | 0.376 | ||
turn | 0.235 | ||
sheet | 0.212 |